H00084701-M01
antibody from Abnova Corporation
Targeting: COX4I2
COX4-2, COX4B, COX4L2, COXIV-2, dJ857M17.2
Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084701-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084701-M01, RRID:AB_509165
- Product name
- COX4I2 monoclonal antibody (M01), clone 1F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant COX4I2.
- Antigen sequence
MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCT
ELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNE
TFAEMNRRSNEWKT- Isotype
- IgG
- Antibody clone number
- 1F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.
Cytochrome c oxidase subunit 4 isoform 2-knockout mice show reduced enzyme activity, airway hyporeactivity, and lung pathology.
Sex- and brain region-specific role of cytochrome c oxidase in 1-methyl-4-phenylpyridinium-mediated astrocyte vulnerability.
Brain region specificity of 3-nitropropionic acid-induced vulnerability of neurons involves cytochrome c oxidase.
Brain region-specific vulnerability of astrocytes in response to 3-nitropropionic acid is mediated by cytochrome c oxidase isoform expression.
Aras S, Pak O, Sommer N, Finley R Jr, Hüttemann M, Weissmann N, Grossman LI
Nucleic acids research 2013 Feb 1;41(4):2255-66
Nucleic acids research 2013 Feb 1;41(4):2255-66
Cytochrome c oxidase subunit 4 isoform 2-knockout mice show reduced enzyme activity, airway hyporeactivity, and lung pathology.
Hüttemann M, Lee I, Gao X, Pecina P, Pecinova A, Liu J, Aras S, Sommer N, Sanderson TH, Tost M, Neff F, Aguilar-Pimentel JA, Becker L, Naton B, Rathkolb B, Rozman J, Favor J, Hans W, Prehn C, Puk O, Schrewe A, Sun M, Höfler H, Adamski J, Bekeredjian R, Graw J, Adler T, Busch DH, Klingenspor M, Klopstock T, Ollert M, Wolf E, Fuchs H, Gailus-Durner V, Hrabě de Angelis M, Weissmann N, Doan JW, Bassett DJ, Grossman LI
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2012 Sep;26(9):3916-30
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2012 Sep;26(9):3916-30
Sex- and brain region-specific role of cytochrome c oxidase in 1-methyl-4-phenylpyridinium-mediated astrocyte vulnerability.
Sundar Boyalla S, Barbara Victor M, Roemgens A, Beyer C, Arnold S
Journal of neuroscience research 2011 Dec;89(12):2068-82
Journal of neuroscience research 2011 Dec;89(12):2068-82
Brain region specificity of 3-nitropropionic acid-induced vulnerability of neurons involves cytochrome c oxidase.
Singh S, Misiak M, Beyer C, Arnold S
Neurochemistry international 2010 Oct;57(3):297-305
Neurochemistry international 2010 Oct;57(3):297-305
Brain region-specific vulnerability of astrocytes in response to 3-nitropropionic acid is mediated by cytochrome c oxidase isoform expression.
Misiak M, Singh S, Drewlo S, Beyer C, Arnold S
Cell and tissue research 2010 Jul;341(1):83-93
Cell and tissue research 2010 Jul;341(1):83-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- COX4I2 monoclonal antibody (M01), clone 1F2. Western Blot analysis of COX4I2 expression in PC-12.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 monoclonal antibody (M01), clone 1F2.Lane 1: COX4I2 transfected lysate (Predicted MW: 20 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged COX4I2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of COX4I2 transfected lysate using anti-COX4I2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with COX4I2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol