HPA014468

APCDD1 antibody from Sigma-Aldrich
B7323
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014468
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014468, RRID:AB_1844919
Product name
Anti-APCDD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014468
Antibody type
Polyclonal
Antigen
Protein APCDD1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSR
GVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNV
FNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPH
TEYEIFKMEQ
Storage
-20C
Provider Type Product Number
- No reagents -