Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311056 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MBOAT1 antibody: synthetic peptide directed towards the N terminal of human MBOAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNF
VVCQL VALFAAFWFR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references LPT1 encodes a membrane-bound O-acyltransferase involved in the acylation of lysophospholipids in the yeast Saccharomyces cerevisiae.
Tamaki H, Shimada A, Ito Y, Ohya M, Takase J, Miyashita M, Miyagawa H, Nozaki H, Nakayama R, Kumagai H
The Journal of biological chemistry 2007 Nov 23;282(47):34288-98
The Journal of biological chemistry 2007 Nov 23;282(47):34288-98
No comments: Submit comment
No validations: Submit validation data