HPA014797

HSPA13 antibody from Sigma-Aldrich
STCH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014797
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014797, RRID:AB_1857567
Product name
Anti-STCH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014797
Antibody type
Polyclonal
Antigen
Stress 70 protein chaperone microsome-associated 60 kDa protein precursor (Microsomal stress 70 protein ATPase core).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFL
TRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVP
SRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVE
EQDRKEPHSSDTELPKDKLSSADDH
Storage
-20C
Provider Type Product Number
- No reagents -