ABIN632100

antibody from antibodies-online

Targeting: ARL8B ARL10C, FLJ10702, Gie1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632100 - Provider product page
Provider: antibodies-online
Product name: anti-ADP-Ribosylation Factor-Like 8B (ARL8B) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: ARL8 B antibody was raised using the middle region of ARL8 corresponding to a region with amino acids SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ARL8B protein structure - ABIN632100 shown in red.