PAB30470

LRFN2 antibody from Abnova Corporation
FIGLER2, KIAA1246, SALM1
No application information provided.

Antibody data

Product number
PAB30470
Provider
Abnova Corporation
Product name
LRFN2 polyclonal antibody
Provider product page
Abnova Corporation - PAB30470
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant human LRFN2.
Antigen sequence
LPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSG
GGEPPKSPPERAVLVSEVTTTSALVKWSVSKSAPR
VKMYQLQYNCSDDEVLIYRMIPASNKAFVVNNLVS
GTGYDLCVLA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -