HPA013653

LRFN2 antibody from Sigma-Aldrich
FIGLER2, KIAA1246, SALM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013653, RRID:AB_1853267
Product name
Anti-LRFN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013653
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and fibronectin type-III domain-containing protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSG
GGEPPKSPPERAVLVSEVTTTSALVKWSVSKSAPR
VKMYQLQYNCSDDEVLIYRMIPASNKAFVVNNLVS
GTGYDLCVLA
Storage
-20C
Provider Type Product Number
- No reagents -