Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042475 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042475, RRID:AB_10964265
- Product name
- Anti-FOXS1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATT
GRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTD
GRPRPPMEPK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references FOXS1 Promotes Tumor Progression by Upregulating CXCL8 in Colorectal Cancer
FOXS1 is regulated by GLI1 and miR-125a-5p and promotes cell proliferation and EMT in gastric cancer
Qiu J, Li M, Su C, Liang Y, Ou R, Chen X, Huang C, Zhang Y, Ye Y, Liao W, Zhang C
Frontiers in Oncology 2022;12
Frontiers in Oncology 2022;12
FOXS1 is regulated by GLI1 and miR-125a-5p and promotes cell proliferation and EMT in gastric cancer
Wang S, Ran L, Zhang W, Leng X, Wang K, Liu G, Song J, Wang Y, Zhang X, Wang Y, Zhang L, Ma Y, Liu K, Li H, Zhang W, Qin G, Song F
Scientific Reports 2019;9(1)
Scientific Reports 2019;9(1)
No comments: Submit comment
No validations: Submit validation data