Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [2]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031582 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031582, RRID:AB_10600901
- Product name
- Anti-DCDC2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETR
GAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKAN
KDAEQKEDFSGMNGDL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression
Jeruschke S, Jeruschke K, DiStasio A, Karaterzi S, Büscher A, Nalbant P, Klein-Hitpass L, Hoyer P, Weiss J, Stottmann R, Weber S, Dryer S
PLOS ONE 2015 September;10(9)
PLOS ONE 2015 September;10(9)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to cytosol & mitotic spindle.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DCDC2 antibody. Corresponding DCDC2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows low expression as expected.
- Sample type
- HUMAN