HPA031582

DCDC2 antibody from Sigma-Aldrich
DCDC2A, DFNB66, KIAA1154, NPHP19, RU2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031582
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031582, RRID:AB_10600901
Product name
Anti-DCDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031582
Antibody type
Polyclonal
Antigen
doublecortin domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETR
GAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKAN
KDAEQKEDFSGMNGDL
Storage
-20C
Provider Type Product Number
- No reagents -