Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502799 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EDEM1 antibody: synthetic peptide directed towards the N terminal of human EDEM1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLG
NYSLT LVDALDTLAI- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references EDEM1 reveals a quality control vesicular transport pathway out of the endoplasmic reticulum not involving the COPII exit sites.
Zuber C, Cormier JH, Guhl B, Santimaria R, Hebert DN, Roth J
Proceedings of the National Academy of Sciences of the United States of America 2007 Mar 13;104(11):4407-12
Proceedings of the National Academy of Sciences of the United States of America 2007 Mar 13;104(11):4407-12
No comments: Submit comment
No validations: Submit validation data