HPA063044

ARID2 antibody from Atlas Antibodies
BAF200, DKFZp686G052, FLJ30619, KIAA1557

Antibody data

Product number
HPA063044
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063044, RRID:AB_2684929
Product name
Anti-ARID2
Provider product page
Atlas Antibodies - HPA063044
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKG
DGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDIT
QQDTAKGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.