HPA007426

TSPAN13 antibody from Sigma-Aldrich
NET-6, TM4SF13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007426
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007426, RRID:AB_10603137
Product name
Anti-TSPAN13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007426
Antibody type
Polyclonal
Antigen
tetraspanin 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCC
GFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGE
V
Storage
-20C
Provider Type Product Number
- No reagents -