HPA013609

EXOG antibody from Sigma-Aldrich
ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013609
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013609, RRID:AB_1848153
Product name
Anti-EXOG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013609
Antibody type
Polyclonal
Antigen
Endonuclease G-like 1 (Endo G-like).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFV
VPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLD
RTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGAR
SVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELK
AKEQSGTQIR
Storage
-20C
Provider Type Product Number
- No reagents -