HPA012532

TMED6 antibody from Sigma-Aldrich
MGC23911, p24g5, p24gamma5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012532
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012532, RRID:AB_1858065
Product name
Anti-TMED6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012532
Antibody type
Polyclonal
Antigen
Transmembrane emp24 domain-containing protein 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGY
FYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQ
GVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLN
FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQ
NN
Storage
-20C
Provider Type Product Number
- No reagents -