HPA012532

TMED6 antibody from Atlas Antibodies
MGC23911, p24g5, p24gamma5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012532
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012532, RRID:AB_1235913
Product name
Anti-TMED6
Provider product page
Atlas Antibodies - HPA012532
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGY
FYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQ
GVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLN
FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQ
NN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -