HPA031958

NALCN antibody from MilliporeSigma / Merck KGaA
bA430M15.1, CanIon, VGCNL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031958
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031958, RRID:AB_10601039
Product name
Anti-NALCN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031958
Antibody type
Polyclonal
Antigen
sodium leak channel, non-selective recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKE
QAEMKRKVQEEELRENHPYFDKPLFIVGREHRFRN
FCRVVVRARFNASKTD
Storage
-20C
Provider Type Product Number
- No reagents -