Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006483-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006483-M01, RRID:AB_607101
- Product name
- ST3GAL2 monoclonal antibody (M01), clone 1E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ST3GAL2.
- Antigen sequence
HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSK
ERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVW
TRENMDLPPDVQRWWMMLQPQFKSHNTNEV- Isotype
- IgG
- Antibody clone number
- 1E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ST3GAL2 monoclonal antibody (M01), clone 1E12 Western Blot analysis of ST3GAL2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 monoclonal antibody (M01), clone 1E12.Lane 1: ST3GAL2 transfected lysate (Predicted MW: 40.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ST3GAL2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ST3GAL2 on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol