Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310850 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 2 (ST3GAL2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHII
DMLAK ASKIEVYRGN- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genomic structure, expression, and transcriptional regulation of human Gal beta 1,3 GalNAc alpha 2,3-sialyltransferase gene.
Taniguchi A, Morishima T, Tsujita Y, Matsumoto Y, Matsumoto K
Biochemical and biophysical research communications 2003 Jan 10;300(2):570-6
Biochemical and biophysical research communications 2003 Jan 10;300(2):570-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting