Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000530 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000530, RRID:AB_2666017
- Product name
- Anti-TYMP
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIR
GFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSV
LTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKV
SLVLAPALAACGCKVPMISG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-431 and Caco-2 using Anti-TYMP antibody. Corresponding TYMP RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line SiHa shows localization to nuclear bodies & the Golgi apparatus.
- Sample type
- HUMAN