HPA001072

TYMP antibody from Atlas Antibodies
ECGF1, MNGIE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001072
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001072, RRID:AB_1080274
Product name
Anti-TYMP
Provider product page
Atlas Antibodies - HPA001072
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIR
GFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSV
LTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKV
SLVLAPALAACGCKVPMISG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -