HPA001072

TYMP antibody from Sigma-Aldrich
ECGF1, MNGIE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001072
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001072, RRID:AB_1080274
Product name
Anti-ECGF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001072
Antibody type
Polyclonal
Antigen
Thymidine phosphorylase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIR
GFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSV
LTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKV
SLVLAPALAACGCKVPMISG
Storage
-20C
Provider Type Product Number
- No reagents -