H00079623-M01

GALNT14 antibody from Abnova Corporation
FLJ12691, GalNac-T10, GalNac-T14

Antibody data

Product number
H00079623-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079623-M01, RRID:AB_1137225
Product name
GALNT14 monoclonal antibody (M01), clone 2A8
Provider product page
Abnova Corporation - H00079623-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GALNT14.
Antigen sequence
KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTE
NGKEIVVNPCESSLMSQHWDMVS
Isotype
IgG
Antibody clone number
2A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -