Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406080 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GALNT14 antibody: synthetic peptide directed towards the middle region of human GALNT14
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKR
TAEVW MDEYKQYYYA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Correlation between hand and total body bone density in normal Chinese children.
N-Acetylgalactosaminyltransferase 14, a novel insulin-like growth factor binding protein-3 binding partner.
Xu H, Chen JX, Zhang TM, Gong J, Wu QL, Wang JP
Bone 2007 Sep;41(3):360-5
Bone 2007 Sep;41(3):360-5
N-Acetylgalactosaminyltransferase 14, a novel insulin-like growth factor binding protein-3 binding partner.
Wu C, Yao G, Zou M, Chen G, Wang M, Liu J, Wang J, Xu D
Biochemical and biophysical research communications 2007 Jun 1;357(2):360-5
Biochemical and biophysical research communications 2007 Jun 1;357(2):360-5
No comments: Submit comment
No validations: Submit validation data