HPA010785

GALNT14 antibody from Sigma-Aldrich
FLJ12691, GalNac-T10, GalNac-T14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010785
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010785, RRID:AB_1078940
Product name
Anti-GALNT14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010785
Antibody type
Polyclonal
Antigen
Polypeptide N-acetylgalactosaminyltransferase 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVAGMSPWAPQVPVSPTPPYQRGHLPTGGHLAVCH
FPCLLQEAQFHLQTQVFLQVR
Storage
-20C
Provider Type Product Number
- No reagents -