HPA029716

ALDH5A1 antibody from MilliporeSigma / Merck KGaA
SSADH, SSDH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029716
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029716, RRID:AB_10601876
Product name
Anti-ALDH5A1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029716
Antibody type
Polyclonal
Antigen
aldehyde dehydrogenase 5 family, member A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMAS
KFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKK
NLRVGNGFEEGTTQGPLINEKAVEKVEKQV
Storage
-20C
Provider Type Product Number
- No reagents -