Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00134430-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00134430-M01, RRID:AB_875930
- Product name
- WDR36 monoclonal antibody (M01), clone 1D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant WDR36.
- Antigen sequence
SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRK
RDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLS
SQVEENWTHLQSLFNQSMCILNYLKSALL- Isotype
- IgG
- Antibody clone number
- 1D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references WDR36 acts as a scaffold protein tethering a G-protein-coupled receptor, Gαq and phospholipase Cβ in a signalling complex.
Identification of early transcripts related to male development in chicken embryos.
Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.
Cartier A, Parent A, Labrecque P, Laroche G, Parent JL
Journal of cell science 2011 Oct 1;124(Pt 19):3292-304
Journal of cell science 2011 Oct 1;124(Pt 19):3292-304
Identification of early transcripts related to male development in chicken embryos.
Lin YP, Chen LR, Chen CF, Liou JF, Chen YL, Yang JR, Shiue YL
Theriogenology 2010 Oct 15;74(7):1161-1178.e1-8
Theriogenology 2010 Oct 15;74(7):1161-1178.e1-8
Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.
Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA
Human molecular genetics 2009 Apr 1;18(7):1276-87
Human molecular genetics 2009 Apr 1;18(7):1276-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged WDR36 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol