Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA142S - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Anti-human FABP5
- Antibody type
- Polyclonal
- Antigen
- Other
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMG
AMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGE
KFEETTADGRKTQTVCNFTDGALVQHQEWDGKEST
ITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHH
H- Vial size
- 100 µg
- Storage
- The lyophilized antibody is stable at room temperature for up to 1 month. The reconstituted antibody is stable for at least two weeks at 2-8 °C. Frozen aliquots are stable for at least 6 months when stored at -20 °C.
- Handling
- The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis of recombinant human FABP5 and FABP4 using a rabbit anti-human FABP5 polyclonal antibody [Cat# 102-PA142]. There is strong cross reaction with recombinant human FABP4.
- Sample type
- Purified recombinant protein
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Double IF staining of human FABP5 and CD31 in a coculture of HDLECs and Balb/C3 cells with a polyclonal rabbit anti-human FABP5 antibody [Cat# 102-PA142; Protein-A purified] and a monoclonal mouse anti-human CD31 antibody [Cat# 101-M92]. Conjugated secondary antibody: goat anti-rabbit ALEXA Flour 488 (1:600) [Dianova], goat anti-mouse PE (1:400) [Santa Cruz].
- Sample type
- HDLEC/Balb/C3 cells