Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA142 - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- Anti-human FABP5
- Antibody type
- Polyclonal
- Antigen
- Other
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMG
AMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGE
KFEETTADGRKTQTVCNFTDGALVQHQEWDGKEST
ITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHH
H- Vial size
- 200 µg
- Storage
- The lyophilized antibody is stable at room temperature for up to 1 month. The reconstituted antibody is stable for at least two weeks at 2-8 °C. Frozen aliquots are stable for at least 6 months when stored at -20 °C.
- Handling
- The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western analysis of recombinant human FABP5 and FABP4 using a rabbit anti-human FABP5 polyclonal antibody [Cat# 102-PA142]. There is strong cross reaction with recombinant human FABP4.
- Sample type
- Purified recombinant protein
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Double IF staining of human FABP5 and CD31 in a coculture of HDLECs and Balb/C3 cells with a polyclonal rabbit anti-human FABP5 antibody [Cat# 102-PA142; Protein-A purified] and a monoclonal mouse anti-human CD31 antibody [Cat# 101-M92]. Conjugated secondary antibody: goat anti-rabbit ALEXA Flour 488 (1:600) [Dianova], goat anti-mouse PE (1:400) [Santa Cruz].
- Sample type
- HDLEC/BalbC3 cells
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Immunofluorescence staining (green) of cryo-sections of human foreskin (fixed 15 min in 4% PFA) with anti-human FABP5 (5µg/ml) [Cat# 102-PA142] and counter staining of nuclei with Dapi (left panel) and control (right panel). The experiment was performed by the research group of Prof. Dr. J. Wilting and Dr. K. Buttler, University Göttingen, Germany.
- Sample type
- human foreskin