HPA010729

ABHD3 antibody from Sigma-Aldrich
LABH3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010729
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010729, RRID:AB_1844449
Product name
Anti-ABHD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010729
Antibody type
Polyclonal
Antigen
Abhydrolase domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKPQLVTGGESFSRFLQDHCPVVTETYYPTVWCWE
GRGQTLLRPFITSKPPVQYRNELIKTADGGQISLD
WFDNDNSTCYMDASTRPTILLLPGLTGTSKESYIL
HMIHLSEELGYRCVVFNNRGVAGENLLTPRTYCCA
NTEDLE
Storage
-20C
Provider Type Product Number
- No reagents -