H00196541-B01

METTL21C antibody from Abnova Corporation
C13orf39, LOC196541

Antibody data

Product number
H00196541-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00196541-B01, RRID:AB_1204624
Product name
LOC196541 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00196541-B01
Antibody type
Polyclonal
Antigen
LOC196541 (NP_001010977, 1 a.a. ~ 264 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQK
DSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEH
YRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEH
AEELNFQDAKILEIGAGPGLVSIVASILGAQVTAT
DLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGED
LDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMV
YLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTL
LAEYPESSVKLFKGILKWD
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -