Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [15]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91081 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91081, RRID:AB_2665793
- Product name
- Anti-VGLUT2
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
CGFIHEDELDEETGDITQNYINYGTTKSYGATTQA
NGGWPSGWEKKEEFVQGEVQDSHSYKDRVDY- Epitope
- Binds to an epitope located within the peptide sequence EETGDITQNYINYGT as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2921
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using AMAb91081 antibody. Corresponding VGLUT2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebellum shows strong immunoreactivity in glutamatergic fibers in the molecular and granular layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse thalamus shows strong immunoreactivity in glutamatergic synapses.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong immunoreactivity in glutamatergic synapses in molecular and granular layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat hippocampal formation shows moderate immunoreactivity in glutamatergic fibers in the dentate gyrus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse cerebellum shows strong positivity in glutamatergic synapses in the molecular and granular layers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of immunoreactivity (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat brain shows moderate to strong positivity in glutamatergic fibers in the cerebellum.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat hippocampus shows moderate positivity in glutamatergic fibers in granular cell layer of the dentate gyrus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows positivity in glutamatergic fibers in the cerebellum.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows strong positivity in glutamatergic fibers in the thalamus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate to strong positivity in glutamatergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
