HPA010793

B4GALT3 antibody from Atlas Antibodies
beta4Gal-T3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010793
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010793, RRID:AB_888220
Product name
Anti-B4GALT3
Provider product page
Atlas Antibodies - HPA010793
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIAT
RVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPH
RFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
ITADIGTDPRGPRAPSGPRYPPGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -