HPA010793

B4GALT3 antibody from Sigma-Aldrich
beta4Gal-T3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010793
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010793, RRID:AB_1078256
Product name
Anti-B4GALT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010793
Antibody type
Polyclonal
Antigen
beta-1,4-Galactosyltransferase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIAT
RVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPH
RFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
ITADIGTDPRGPRAPSGPRYPPGS
Storage
-20C
Provider Type Product Number
- No reagents -