HPA017202

CACHD1 antibody from Sigma-Aldrich
KIAA1573, VWCD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017202
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017202, RRID:AB_1852423
Product name
Anti-CACHD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017202
Antibody type
Polyclonal
Antigen
VWFA and cache domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVN
LAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLT
RPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPL
GSQIIAVPVNSSLSWHINKLRETGKEA
Storage
-20C
Provider Type Product Number
- No reagents -