HPA031245

RIPOR2 antibody from MilliporeSigma / Merck KGaA
C6orf32, DIFF48, FAM65B, KIAA0386, MYONAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031245
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031245, RRID:AB_10603666
Product name
Anti-FAM65B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031245
Antibody type
Polyclonal
Antigen
family with sequence similarity 65, member B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPFVARSLLEKLSRQIQVMEKLAAVSDENIGNISS
VVEAIPEFHKKLSLLSFWTKCCSPVGVYHSPADRV
MKQLEASFARTVNKEYPGLADPVFRTLVS
Storage
-20C
Provider Type Product Number
- No reagents -