HPA010641

CYB5R1 antibody from Atlas Antibodies
humb5R2, NQO3A2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010641
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010641, RRID:AB_1078600
Product name
Anti-CYB5R1
Provider product page
Atlas Antibodies - HPA010641
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHH
TLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQG
YVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDV
VEFRGPSGLLTYTGKGHFNIQPNKKSPPEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -