HPA014147

CYB5R1 antibody from Sigma-Aldrich
humb5R2, NQO3A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014147
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014147, RRID:AB_1847370
Product name
Anti-CYB5R1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014147
Antibody type
Polyclonal
Antigen
NADH-cytochrome b5 reductase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEK
DIILREDLEELQARYPNRFKLWFTLDHPPKDWAYS
KGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLAC
HPNLDKLGYSQKMRFTY
Storage
-20C
Provider Type Product Number
- No reagents -