H00007905-M04

REEP5 antibody from Abnova Corporation
C5orf18, D5S346, DP1, TB2, Yip2e

Antibody data

Product number
H00007905-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007905-M04, RRID:AB_1204036
Product name
C5orf18 monoclonal antibody (M04), clone 3G11
Provider product page
Abnova Corporation - H00007905-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant C5orf18.
Antigen sequence
KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQ
MDSVVKDLKDKAKETADAITKEAKKATVNLLGEEK
KS
Isotype
IgG
Antibody clone number
3G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -