HPA011938

EFCAB14 antibody from Sigma-Aldrich
KIAA0494
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011938
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011938, RRID:AB_1852317
Product name
Anti-KIAA0494 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011938
Antibody type
Polyclonal
Antigen
EF-hand domain-containing protein KIAA0494 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKVWINITEMNKQISLLTSAVNHLKANVKSAADLI
SLPTTVEGLQKSVASIGNTLNSVHLAVEALQKTVD
EHKKTMELLQSDMNQHFLKETPGSNQIIPSPSATS
ELDNKTHSENLKQDILYLHNSLEEVNSALV
Storage
-20C
Provider Type Product Number
- No reagents -