Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003696-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003696-M01, RRID:AB_565871
- Product name
- ITGB8 monoclonal antibody (M01), clone 2B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITGB8.
- Antigen sequence
VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSND
EVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKI
HIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDE
NKCHFDE- Isotype
- IgG
- Antibody clone number
- 2B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references β5 integrin is the major contributor to the αVintegrin-mediated blockade of HIV-1 replication.
Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Esté JA
Journal of immunology (Baltimore, Md. : 1950) 2011 Jan 1;186(1):464-70
Journal of immunology (Baltimore, Md. : 1950) 2011 Jan 1;186(1):464-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ITGB8 expression in transfected 293T cell line by ITGB8 monoclonal antibody (M01), clone 2B4.Lane 1: ITGB8 transfected lysate(85.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ITGB8 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ITGB8 transfected lysate using anti-ITGB8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ITGB8 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol