HPA027796

ITGB8 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027796
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027796, RRID:AB_10600299
Product name
Anti-ITGB8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027796
Antibody type
Polyclonal
Antigen
integrin, beta 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIG
Storage
-20C
Provider Type Product Number
- No reagents -