HPA027797

ITGB8 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027797
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027797, RRID:AB_10600879
Product name
Anti-ITGB8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027797
Antibody type
Polyclonal
Antigen
integrin, beta 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFC
EHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKT
SCALMEQQHY
Storage
-20C
Provider Type Product Number
- No reagents -