HPA017975

LRRC3 antibody from Sigma-Aldrich
C21orf102
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017975
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017975, RRID:AB_1853307
Product name
Anti-LRRC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017975
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISH
LPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAG
GLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLH
CECALQEALWELKLDPDSVDEIACHTSVQEEFVGK
P
Storage
-20C
Provider Type Product Number
- No reagents -