HPA017975

LRRC3 antibody from Atlas Antibodies
C21orf102, C21orf30, DKFZP434C128, LRRC3DN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017975
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017975, RRID:AB_1853307
Product name
Anti-LRRC3
Provider product page
Atlas Antibodies - HPA017975
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISH
LPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAG
GLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLH
CECALQEALWELKLDPDSVDEIACHTSVQEEFVGK
P
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -