HPA017163

PLBD2 antibody from Sigma-Aldrich
p76
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017163
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017163, RRID:AB_1853029
Product name
Anti-PLBD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017163
Antibody type
Polyclonal
Antigen
Putative phospholipase B-like 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYN
DFLHDPLSLCKACNPQPNGENAISARSDLNPANGS
YPFQALRQRSHGGIDVKVTSMSLARILSLLAASGP
TWDQVPPFQWSTS
Storage
-20C
Provider Type Product Number
- No reagents -