Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000318-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000318-M01, RRID:AB_425306
- Product name
- NUDT2 monoclonal antibody (M01), clone 4A4-3C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NUDT2.
- Antigen sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGI
HHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEI
RLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ
FLCSIEA- Isotype
- IgG
- Antibody clone number
- 4A4-3C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nudix-type motif 2 in human breast carcinoma: a potent prognostic factor associated with cell proliferation.
Oka K, Suzuki T, Onodera Y, Miki Y, Takagi K, Nagasaki S, Akahira J, Ishida T, Watanabe M, Hirakawa H, Ohuchi N, Sasano H
International journal of cancer 2011 Apr 15;128(8):1770-82
International journal of cancer 2011 Apr 15;128(8):1770-82
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NUDT2 monoclonal antibody (M01), clone 4A4-3C3 Western Blot analysis of NUDT2 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NUDT2 expression in transfected 293T cell line by NUDT2 monoclonal antibody (M01), clone 4A4-3C3.Lane 1: NUDT2 transfected lysate(16.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NUDT2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol