Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000318-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000318-D01, RRID:AB_10720488
- Product name
- NUDT2 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human NUDT2 protein.
- Antigen sequence
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGI
HHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEI
RLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ
FLCSIEA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NUDT2 expression in transfected 293T cell line (H00000318-T01) by NUDT2 MaxPab polyclonal antibody.Lane 1: NUDT2 transfected lysate(16.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NUDT2 transfected lysate using anti-NUDT2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NUDT2 purified MaxPab mouse polyclonal antibody (B01P) (H00000318-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol