Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083942-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083942-M01, RRID:AB_464121
- Product name
- TSSK1 monoclonal antibody (M01), clone 4F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TSSK1.
- Antigen sequence
LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPE
PGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMS
RQSEILGFPSKPSTMETEEGPPQQPPETRAQ- Isotype
- IgG
- Antibody clone number
- 4F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis.
Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM
Molecular human reproduction 2011 Jan;17(1):42-56
Molecular human reproduction 2011 Jan;17(1):42-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TSSK1 expression in transfected 293T cell line by TSSK1 monoclonal antibody (M01), clone 4F12.Lane 1: TSSK1 transfected lysate(41.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TSSK1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol