H00083942-B01P

TSSK1B antibody from Abnova Corporation
FKSG81, SPOGA4, STK22D, TSSK1

Antibody data

Product number
H00083942-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083942-B01P, RRID:AB_1237970
Product name
TSSK1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00083942-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TSSK1 protein.
Antigen sequence
MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLK
FNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC
SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTR
GALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD
NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTF
CGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV
CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGEC
KDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP
SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPE
GEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST
METEEGPPQQPPETRAQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -